Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Profilin1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 61-140 of human PFN1 (P07737) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Profilin1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 61-140 of human PFN1 (P07737) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16131A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Profilin1 |
| Target Synonyms | ALS18; Profilin1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, NIH/3T3, A549, Mouse brain, Mouse thymus, Rat kidney, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 61-140 of human PFN1 (P07737). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY | Uniprot ID | P07737 |
Uniprot Id
P07737
Target Species
Human
Target Name
PFN1
Target Full Name
Profilin-1
Target Function
Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG. Inhibits androgen receptor (AR) and HTT aggregation and binding of G-actin is essential for its inhibition of AR.
Target Involvement
Amyotrophic lateral sclerosis 18 (ALS18)
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Profilin family
Target Tissue Specificity
Expressed in epididymis (at protein level).
Target Research Area
Neuroscience
Target Synonyms
Actin binding protein ; ALS18; Epididymis tissue protein Li 184a; OTTHUMP00000125244; PFN 1; Pfn; PFN1; PROF1_HUMAN; Profilin I; Profilin-1; Profilin1; ProfilinI
Target Background
This gene encodes a member of the profilin family of small actin-binding proteins. The encoded protein plays an important role in actin dynamics by regulating actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome, and the encoded protein may also play a role in Huntington disease. Multiple pseudogenes of this gene are located on chromosome 1.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
