-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PON1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PON1 (P27169) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PON1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PON1 (P27169) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16199A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PON1 |
| Target Synonyms | ESA; PON; MVCD5; PON1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PON1 (P27169). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEE | Uniprot ID | P27169 |
Uniprot Id
P27169
Target Species
Human
Target Name
PON1
Target Full Name
Serum paraoxonase/arylesterase 1
Target Function
Hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. Capable of hydrolyzing a broad spectrum of organophosphate substrates and lactones, and a number of aromatic carboxylic acid esters. Mediates an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation.
Target Involvement
Microvascular complications of diabetes 5 (MVCD5)
Target Subcellular Location
Secreted, extracellular space.
Target Protein Families
Paraoxonase family
Target Tissue Specificity
Plasma, associated with HDL (at protein level). Expressed in liver, but not in heart, brain, placenta, lung, skeletal muscle, kidney or pancreas.
Target Synonyms
A esterase 1; A-esterase 1; Aromatic esterase 1; Arylesterase 1; Arylesterase B type; ESA; Esterase A; K 45; K-45; MVCD5; Paraoxonase 1; Paraoxonase; Paraoxonase B type; Paraoxonase, plasma; Paraoxonase1; PON 1; PON; PON1; PON1_HUMAN; Serum aryldiakylphosphatase; Serum aryldialkylphosphatase 1; Serum paraoxonase/arylesterase 1
Target Background
This gene encodes a member of the paraoxonase family of enzymes and exhibits lactonase and ester hydrolase activity. Following synthesis in the kidney and liver, the enzyme is secreted into the circulation, where it binds to high density lipoprotein (HDL) particles and hydrolyzes thiolactones and xenobiotics, including paraoxon, a metabolite of the insecticide parathion. Polymorphisms in this gene may be associated with coronary artery disease and diabetic retinopathy. The gene is found in a cluster of three related paraoxonase genes on chromosome 7.
Notification