-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYPOR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human CYPOR (P16435) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CYPOR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human CYPOR (P16435) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16208A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYPOR |
| Target Synonyms | CPR; CYPOR; P450R | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Mouse brain, Mouse liver, Mouse lung, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human CYPOR (P16435). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRI | Uniprot ID | P16435 |
Uniprot Id
P16435
Target Species
Human
Target Name
POR
Target Full Name
NADPH--cytochrome P450 reductase
Target Function
This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5.
Target Involvement
Antley-Bixler syndrome, with genital anomalies and disordered steroidogenesis (ABS1); Disordered steroidogenesis due to cytochrome P450 oxidoreductase deficiency (DISPORD)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side.
Target Protein Families
NADPH--cytochrome P450 reductase family; Flavodoxin family; Flavoprotein pyridine nucleotide cytochrome reductase family
Target Synonyms
CPR; CYPOR; Cytochrome p450 oxidoreductase; DKFZp686G04235; FLJ26468; NADPH Cytochrome P450 Reductase; NADPH dependent cytochrome P450 reductase; NADPH--cytochrome P450 reductase; NCPR_HUMAN; P450 (cytochrome) oxidoreductase; P450 Cytochrome Oxidoreductase; P450R; por
Target Background
This gene encodes an endoplasmic reticulum membrane oxidoreductase that is essential for multiple metabolic processes, including reactions catalyzed by cytochrome P450 proteins for metabolism of steroid hormones, drugs and xenobiotics. The encoded protein has a flavin adenine dinucleotide (FAD)-binding domain and a flavodoxin-like domain which bind two cofactors, FAD and FMN, that allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene cause a complex set of disorders, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome, that resemble those caused by defects in steroid metabolizing enzymes such as aromatase, 21-hydroxylase, and 17 alpha-hydroxylase.
Notification