Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HSPA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human HSPA4 (P34932) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against HSPA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human HSPA4 (P34932) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16246A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HSPA4 |
| Target Synonyms | RY; APG-2; HSPH2; hsp70; hsp70RY; HEL-S-5a; HS24/P52; HSPA4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, NIH/3T3, 293T, K-562, Mouse testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human HSPA4 (P34932). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNA | Uniprot ID | P34932 |
Uniprot Id
P34932
Target Species
Human
Target Name
HSPA4
Target Full Name
Heat shock 70 kDa protein 4
Target Subcellular Location
Cytoplasm.
Target Protein Families
Heat shock protein 70 family
Target Synonyms
APG 2; Epididymis secretory sperm binding protein Li 5a; Heat shock 70 kDa protein 4; Heat shock 70 related protein APG 2; Heat shock 70-related protein APG-2; Heat shock protein, 110 kDa; HEL S 5a; HS24/P52; hsp70; Hsp70 RY; hsp70RY; HSP74_HUMAN; HSPA4; HSPH2; MGC131852; RY
Target Background
Predicted to enable ATP binding activity. Involved in chaperone-mediated protein complex assembly and protein insertion into mitochondrial outer membrane. Located in cytosol and extracellular exosome. Implicated in Chagas disease. Biomarker of chronic obstructive pulmonary disease; rheumatoid arthritis; type 2 diabetes mellitus; and ulcerative colitis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
