-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FGF7/KGF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF7/FGF7/KGF (NP_002000.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FGF7/KGF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF7/FGF7/KGF (NP_002000.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16251A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FGF7/KGF |
| Target Synonyms | KGF; HBGF-7; Fibroblast growth factor 7; FGF7/KGF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A549, Mouse lung, Mouse spleen, Mouse uterus, Raji, Rat lung, Rat spleen, Rat uterus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGF7/FGF7/KGF (NP_002000.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEI | Uniprot ID | P21781 |
Uniprot Id
P21781
Target Species
Human
Target Name
FGF7
Target Full Name
Fibroblast growth factor 7
Target Function
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
Target Subcellular Location
Secreted.
Target Protein Families
Heparin-binding growth factors family
Target Tissue Specificity
Epithelial cell.
Target Synonyms
FGF 7; FGF-7; Fgf7; FGF7_HUMAN; Fibroblast growth factor 7; HBGF 7; HBGF-7; HBGF7; Heparin binding growth factor 7; Heparin-binding growth factor 7; Keratinocyte growth factor; KGF
Target Background
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis.
Notification