-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KAT2B/PCAF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-450 of human KAT2B/PCAF (NP_003875.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against KAT2B/PCAF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-450 of human KAT2B/PCAF (NP_003875.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16377A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KAT2B/PCAF |
| Target Synonyms | CAF; PCAF; P/CAF; KAT2B/PCAF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 360-450 of human KAT2B/PCAF (NP_003875.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIP | Uniprot ID | Q92831 |
Uniprot Id
Q92831
Target Species
Human
Target Name
KAT2B
Target Full Name
Histone acetyltransferase KAT2B
Target Function
Functions as a histone acetyltransferase (HAT) to promote transcriptional activation. Has significant histone acetyltransferase activity with core histones (H3 and H4), and also with nucleosome core particles. Also acetylates non-histone proteins, such as ACLY, PLK4, RRP9/U3-55K and TBX5. Inhibits cell-cycle progression and counteracts the mitogenic activity of the adenoviral oncoprotein E1A. Acts as a circadian transcriptional coactivator which enhances the activity of the circadian transcriptional activators: NPAS2-ARNTL/BMAL1 and CLOCK-ARNTL/BMAL1 heterodimers. Involved in heart and limb development by mediating acetylation of TBX5, acetylation regulating nucleocytoplasmic shuttling of TBX5. Acts as a negative regulator of centrosome amplification by mediating acetylation of PLK4. Acetylates RRP9/U3-55K, a core subunit of the U3 snoRNP complex, impairing pre-rRNA processing. Also acetylates spermidine.; (Microbial infection) In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes.
Target Involvement
Defects in KAT2B has been found in a patient with isolated coloboma, a defect of the eye characterized by the absence of ocular structures due to abnormal morphogenesis of the optic cup and stalk, and the fusion of the fetal fissure (optic fissure). Isolated colobomas may be associated with an abnormally small eye (microphthalmia) or small cornea.
Target Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm.
Target Protein Families
Acetyltransferase family, GCN5 subfamily
Target Tissue Specificity
Ubiquitously expressed but most abundant in heart and skeletal muscle. Also expressed in the skin, in keratinocytes (at protein level).
Target Synonyms
CAF; CREBBP associated factor; GCN5; GCN5L; GCN5L1; Histone acetylase PCAF; Histone acetyltransferase KAT2B; Histone acetyltransferase PCAF; K(lysine) acetyltransferase 2B; KAT2B; KAT2B_HUMAN; Lysine acetyltransferase 2B; P; P/CAF; p300/CBP associated factor; P300/CBP-associated factor; Pcaf
Target Background
CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.
Notification