-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BRAF V600E was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 507-606 of B-Raf (NP_004324.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against BRAF V600E was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 507-606 of B-Raf (NP_004324.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16435A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BRAF V600E |
| Target Synonyms | NS7; B-raf; BRAF1; RAFB1; B-RAF1; BRAF-1; BRAF V600E | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T transfected with BRAF V600E | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 507-606 of B-Raf (NP_004324.2). | Immunogen Sequence | KTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSG |
|---|---|---|---|
| Uniprot ID | P15056 |
Uniprot Id
P15056
Target Species
Human
Target Name
BRAF
Target Full Name
Serine/threonine-protein kinase B-raf
Target Function
Protein kinase involved in the transduction of mitogenic signals from the cell membrane to the nucleus (Probable). Phosphorylates MAP2K1, and thereby activates the MAP kinase signal transduction pathway. May play a role in the postsynaptic responses of hippocampal neurons.
Target Involvement
Colorectal cancer (CRC); Lung cancer (LNCR); Familial non-Hodgkin lymphoma (NHL); Cardiofaciocutaneous syndrome 1 (CFC1); Noonan syndrome 7 (NS7); LEOPARD syndrome 3 (LPRD3)
Target Subcellular Location
Nucleus. Cytoplasm. Cell membrane.
Target Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily
Target Tissue Specificity
Brain and testis.
Target Synonyms
FLJ95109; 94 kDa B raf protein; B raf 1; B raf; B Raf proto oncogene serine threonine protein kinase; B Raf proto oncogene; serine/threonine kinase; B RAF1; B-Raf proto-oncogene serine/threonine-protein kinase (p94); BRAF 1; BRAF; BRAF_HUMAN; BRAF1; cRmil; MGC126806; MGC138284; Murine sarcoma viral (v-raf) oncogene homolog B1; Murine sarcoma viral v raf oncogene homolog B1; NS7; Oncogen BRAF; oncogene BRAF1; p94; Proto-oncogene B-Raf; Proto-oncogene c-Rmil; RAFB 1; RAFB1; RMIL; Serine/threonine-protein kinase B-raf; v raf murine sarcoma viral oncogene homolog B; v raf murine sarcoma viral oncogene homolog B1; v-Raf murine sarcoma viral oncogene homolog B1
Target Background
This gene encodes a protein belonging to the RAF family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERK signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene, most commonly the V600E mutation, are the most frequently identified cancer-causing mutations in melanoma, and have been identified in various other cancers as well, including non-Hodgkin lymphoma, colorectal cancer, thyroid carcinoma, non-small cell lung carcinoma, hairy cell leukemia and adenocarcinoma of lung. Mutations in this gene are also associated with cardiofaciocutaneous, Noonan, and Costello syndromes, which exhibit overlapping phenotypes. A pseudogene of this gene has been identified on the X chromosome.
Notification