-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WDR5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 235-334 of human WDR5 (NP_060058.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against WDR5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 235-334 of human WDR5 (NP_060058.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16459A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WDR5 |
| Target Synonyms | BIG3; SWD3; BIG-3; CFAP89; WDR5 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A549, HT-1080, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 235-334 of human WDR5 (NP_060058.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC | Uniprot ID | P61964 |
Uniprot Id
P61964
Target Species
Human
Target Name
WDR5
Target Full Name
WD repeat-containing protein 5
Target Function
Contributes to histone modification. May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. May regulate osteoblasts differentiation. In association with RBBP5 and ASH2L, stimulates the histone methyltransferase activities of KMT2A, KMT2B, KMT2C, KMT2D, SETD1A and SETD1B.
Target Subcellular Location
Nucleus.
Target Protein Families
WD repeat WDR5/wds family
Target Research Area
Transcription
Target Synonyms
2410008O07Rik; AA408785; AA960360; BIG 3; Big; BIG3; BMP2 induced 3 kb gene protein; BMP2 induced gene; 3-KB; BMP2-induced 3-kb gene protein; MGC114572; OTTHUMP00000162494; SWD 3; SWD3; SWD3 Set1c WD40 repeat protein homolog; WD repeat containing protein 5; WD repeat domain 5; WD repeat protein 5; WD repeat-containing protein 5; WD repeat-containing protein BIG-3; WDR 5; Wdr5; WDR5_HUMAN
Target Background
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified.
Notification