Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RRM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-117 of human RRM2 (P31350) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RRM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-117 of human RRM2 (P31350) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16460A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RRM2 |
| Target Synonyms | R2; RR2; RR2M; C2orf48; RRM2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-375, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-117 of human RRM2 (P31350). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWE | Uniprot ID | P31350 |
Uniprot Id
P31350
Target Species
Human
Target Name
RRM2
Target Full Name
Ribonucleoside-diphosphate reductase subunit M2
Target Function
Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Ribonucleoside diphosphate reductase small chain family
Target Research Area
Transcription
Target Synonyms
cb111; chunp6884; etID309896.20; R2; reductase M2 polypeptide variant 1; reductase M2 polypeptide variant 2; reductase M2 polypeptide variant 3a; reductase M2 polypeptide variant 3b; reductase M2 polypeptide variant 3c; reductase M2 polypeptide variant 3d; Ribonucleoside-diphosphate reductase subunit M2; Ribonucleotide reductase M2; Ribonucleotide reductase M2 polypeptide; Ribonucleotide reductase M2 subunit; ribonucleotide reductase protein r2 class I; Ribonucleotide reductase regulatory subunit M2; Ribonucleotide reductase small chain; Ribonucleotide reductase small subunit; Ribonucleotide reductase, R2 subunit; RIR2_HUMAN; RR2; RR2M; RRM2
Target Background
This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
