-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-250 of human WT1 (P19544) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against WT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-250 of human WT1 (P19544) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16514A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WT1 |
| Target Synonyms | GUD; AWT1; WAGR; WT-1; WT33; NPHS4; WIT-2; WT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse testis, OVCAR3, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-250 of human WT1 (P19544). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGV | Uniprot ID | P19544 |
Uniprot Id
P19544
Target Species
Human
Target Name
WT1
Target Full Name
Wilms tumor protein
Target Function
Transcription factor that plays an important role in cellular development and cell survival. Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'. Regulates the expression of numerous target genes, including EPO. Plays an essential role for development of the urogenital system. It has a tumor suppressor as well as an oncogenic role in tumor formation. Function may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA.
Target Involvement
Frasier syndrome (FS); Wilms tumor 1 (WT1); Denys-Drash syndrome (DDS); Nephrotic syndrome 4 (NPHS4); Meacham syndrome (MEACHS); Mesothelioma, malignant (MESOM)
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Cytoplasm.; [Isoform 1]: Nucleus speckle.; [Isoform 4]: Nucleus, nucleoplasm.
Target Protein Families
EGR C2H2-type zinc-finger protein family
Target Tissue Specificity
Expressed in the kidney and a subset of hematopoietic cells.
Target Research Area
Cancer, Transcription
Target Synonyms
WIT 2; WT 1; AWT1; FWT1; GUD; NPHS4; WAGR; Wilms tumor 1; Wilms Tumor; Wilms tumor protein; Wilms' tumor gene; Wilms' tumor protein; WIT2; WT; WT1; WT1_HUMAN; WT33
Target Background
This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilms tumor. This gene exhibits complex tissue-specific and polymorphic imprinting pattern, with biallelic, and monoallelic expression from the maternal and paternal alleles in different tissues. Multiple transcript variants have been described. In several variants, there is evidence for the use of a non-AUG (CUG) translation initiation codon upstream of, and in-frame with the first AUG. Authors of PMID:7926762 also provide evidence that WT1 mRNA undergoes RNA editing in human and rat, and that this process is tissue-restricted and developmentally regulated.
Notification