Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GCLC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 538-637 of human GCLC (P48506) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GCLC was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 538-637 of human GCLC (P48506) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16596A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GCLC |
| Target Synonyms | GCL; GCS; GLCL; GLCLC; GCLC | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Rat kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 538-637 of human GCLC (P48506). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN | Uniprot ID | P48506 |
Uniprot Id
P48506
Target Species
Human
Target Name
GCLC
Target Full Name
Glutamate--cysteine ligase catalytic subunit
Target Involvement
Hemolytic anemia due to gamma-glutamylcysteine synthetase deficiency (HAGGSD)
Target Protein Families
Glutamate--cysteine ligase type 3 family
Target Synonyms
EC 6.3.2.2; Gamma ECS; Gamma glutamylcysteine synthetase; Gamma-ECS; Gamma-glutamylcysteine synthetase; GCL; Gclc; GCS; GCS heavy chain; GLCL; GLCLC; Glutamate cysteine ligase catalytic subunit; Glutamate--cysteine ligase catalytic subunit; GSH1_HUMAN
Target Background
Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate-limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. This locus encodes the catalytic subunit, while the regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Mutations at this locus have been associated with hemolytic anemia due to deficiency of gamma-glutamylcysteine synthetase and susceptibility to myocardial infarction.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
