-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD62P/P-selectin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 731-830 of human CD62P/P-selectin (P16109) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD62P/P-selectin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 731-830 of human CD62P/P-selectin (P16109) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16612A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD62P/P-selectin |
| Target Synonyms | CD62; GRMP; PSEL; CD62P; GMP140; LECAM3; PADGEM; CD62P/P-selectin | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, Jurkat, Mouse liver, Mouse lung, Mouse spleen, Rat liver, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 731-830 of human CD62P/P-selectin (P16109). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVASTIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP | Uniprot ID | P16109 |
Uniprot Id
P16109
Target Species
Human
Target Name
SELP
Target Full Name
P-selectin
Target Function
Ca(2+)-dependent receptor for myeloid cells that binds to carbohydrates on neutrophils and monocytes. Mediates the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized is sialyl-Lewis X. Mediates rapid rolling of leukocyte rolling over vascular surfaces during the initial steps in inflammation through interaction with SELPLG.
Target Involvement
Ischemic stroke (ISCHSTR)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Selectin/LECAM family
Target Tissue Specificity
Stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. Upon cell activation by agonists, P-selectin is transported rapidly to the cell surface.
Target Research Area
Cardiovascular
Target Synonyms
CD62 antigen-like family member P;Granule membrane protein 140;GMP-140;Leukocyte-endothelial cell adhesion molecule 3;LECAM3;Platelet activation dependent granule-external membrane protein;PADGEM;CD62P
Target Background
This gene encodes a 140 kDa protein that is stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. This protein redistributes to the plasma membrane during platelet activation and degranulation and mediates the interaction of activated endothelial cells or platelets with leukocytes. The membrane protein is a calcium-dependent receptor that binds to sialylated forms of Lewis blood group carbohydrate antigens on neutrophils and monocytes. Alternative splice variants may occur but are not well documented.
Notification