-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ACTN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ACTN2 (P35609) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ACTN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ACTN2 (P35609) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16623A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ACTN2 |
| Target Synonyms | MPD6; CMH23; CMYP8; CMD1AA; MYOCOZ; ACTN2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse lung, Mouse skeletal muscle, Rat skeletal muscle, RD | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ACTN2 (P35609). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANV | Uniprot ID | P35609 |
Uniprot Id
P35609
Target Species
Human
Target Name
ACTN2
Target Full Name
Alpha-actinin-2
Target Function
F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.
Target Involvement
Cardiomyopathy, familial hypertrophic 23, with or without left ventricular non-compaction (CMH23); Cardiomyopathy, dilated 1AA, with or without left ventricular non-compaction (CMD1AA)
Target Subcellular Location
Cytoplasm, myofibril, sarcomere, Z line. Note=Colocalizes with MYOZ1 and FLNC at the Z-lines of skeletal muscle.
Target Protein Families
Alpha-actinin family
Target Tissue Specificity
Expressed in both skeletal and cardiac muscle.
Target Synonyms
Actin binding protein; Actinin alpha 2; ACTN 2; ACTN2; ACTN2_HUMAN; Alpha actinin 2; Alpha actinin skeletal muscle; Alpha actinin skeletal muscle isoform 2; Alpha-actinin skeletal muscle isoform 2; Alpha-actinin-2; CMD1AA; F actin cross linking protein; F-actin cross-linking protein
Target Background
Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a muscle-specific, alpha actinin isoform that is expressed in both skeletal and cardiac muscles. Several transcript variants encoding different isoforms have been found for this gene.
Notification