-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MELK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MELK (NP_055606.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MELK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MELK (NP_055606.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16813A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MELK |
| Target Synonyms | HPK38; MELK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, K-562, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MELK (NP_055606.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIIS | Uniprot ID | Q14680 |
Uniprot Id
Q14680
Target Species
Human
Target Name
MELK
Target Full Name
Maternal embryonic leucine zipper kinase
Target Function
Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.
Target Involvement
Defects in MELK are associated with some cancers, such as brain or breast cancers. Expression is dramatically increased in aggressive undifferentiated tumors, correlating with poor patient outcome in breast and brain cancers, suggesting a role in tumor-initiating cells and proliferation via its function in cell proliferation regulation.
Target Subcellular Location
Cell membrane; Peripheral membrane protein.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, SNF1 subfamily
Target Tissue Specificity
Expressed in placenta, kidney, thymus, testis, ovary and intestine.
Target Research Area
Cell Biology
Target Synonyms
AI327312; hMELK; HPK 38; hPK38; KIAA0175; Likely ortholog of maternal embryonic leucine zipper kinase; Maternal embryonic leucine zipper kinase; MELK; MELK_HUMAN; mKIAA0175; MPK38; OTTHUMP00000021377; OTTHUMP00000046113; pEg3 kinase; Protein kinase Eg3; Protein kinase PK38; RP23 382O11.1; Tyrosine protein kinase MELK
Target Background
Enables calcium ion binding activity; non-membrane spanning protein tyrosine kinase activity; and protein serine/threonine kinase activity. Involved in apoptotic process; cell population proliferation; and protein autophosphorylation. Located in cell cortex and plasma membrane.
Notification