-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD133 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-380 of human CD133 (O43490) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD133 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-380 of human CD133 (O43490) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16822A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD133 |
| Target Synonyms | RP41; AC133; CD133; MCDR2; STGD4; CORD12; PROML1; MSTP061; 33 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-380 of human CD133 (O43490). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQGYQSLNDIPDRVQRQTTTVVA | Uniprot ID | O43490 |
Uniprot Id
O43490
Target Species
Human
Target Name
PROM1
Target Full Name
Prominin-1
Target Function
May play a role in cell differentiation, proliferation and apoptosis. Binds cholesterol in cholesterol-containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner.
Target Involvement
Retinitis pigmentosa 41 (RP41); Cone-rod dystrophy 12 (CORD12); Stargardt disease 4 (STGD4); Retinal macular dystrophy 2 (MCDR2)
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Cell projection, microvillus membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment. Endoplasmic reticulum. Endoplasmic reticulum-Golgi intermediate compartment. Note=Found in extracellular membrane particles in various body fluids such as cerebrospinal fluid, saliva, seminal fluid and urine.
Target Protein Families
Prominin family
Target Tissue Specificity
Isoform 1 is selectively expressed on CD34 hematopoietic stem and progenitor cells in adult and fetal bone marrow, fetal liver, cord blood and adult peripheral blood. Isoform 1 is not detected on other blood cells. Isoform 1 is also expressed in a number
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
AC133; Antigen AC133; CD133; CORD12; Hematopoietic stem cell antigen; hProminin; MCDR2; MSTP061; OTTHUMP00000217744; OTTHUMP00000217745; OTTHUMP00000217746; PROM1; PROM1_HUMAN; Prominin I; Prominin like 1; Prominin like protein 1 precursor; Prominin mouse like 1; Prominin-1; Prominin-like protein 1; Prominin1; PROML1; RP41; STGD4
Target Background
This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification