-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BTK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 560-659 of human BTK (Q06187) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against BTK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 560-659 of human BTK (Q06187) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16863A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BTK |
| Target Synonyms | AT; ATK; BPK; XLA; IMD1; AGMX1; IGHD3; PSCTK1; BTK | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Raji | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 560-659 of human BTK (Q06187). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES | Uniprot ID | Q06187 |
Uniprot Id
Q06187
Target Species
Human
Target Name
BTK
Target Full Name
Tyrosine-protein kinase BTK
Target Function
Non-receptor tyrosine kinase indispensable for B lymphocyte development, differentiation and signaling. Binding of antigen to the B-cell antigen receptor (BCR) triggers signaling that ultimately leads to B-cell activation. After BCR engagement and activation at the plasma membrane, phosphorylates PLCG2 at several sites, igniting the downstream signaling pathway through calcium mobilization, followed by activation of the protein kinase C (PKC) family members. PLCG2 phosphorylation is performed in close cooperation with the adapter protein B-cell linker protein BLNK. BTK acts as a platform to bring together a diverse array of signaling proteins and is implicated in cytokine receptor signaling pathways. Plays an important role in the function of immune cells of innate as well as adaptive immunity, as a component of the Toll-like receptors (TLR) pathway. The TLR pathway acts as a primary surveillance system for the detection of pathogens and are crucial to the activation of host defense. Especially, is a critical molecule in regulating TLR9 activation in splenic B-cells. Within the TLR pathway, induces tyrosine phosphorylation of TIRAP which leads to TIRAP degradation. BTK plays also a critical role in transcription regulation. Induces the activity of NF-kappa-B, which is involved in regulating the expression of hundreds of genes. BTK is involved on the signaling pathway linking TLR8 and TLR9 to NF-kappa-B. Transiently phosphorylates transcription factor GTF2I on tyrosine residues in response to BCR. GTF2I then translocates to the nucleus to bind regulatory enhancer elements to modulate gene expression. ARID3A and NFAT are other transcriptional target of BTK. BTK is required for the formation of functional ARID3A DNA-binding complexes. There is however no evidence that BTK itself binds directly to DNA. BTK has a dual role in the regulation of apoptosis.
Target Involvement
X-linked agammaglobulinemia (XLA); X-linked hypogammaglobulinemia and isolated growth hormone deficiency (XLA-IGHD)
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein. Nucleus. Note=In steady state, BTK is predominantly cytosolic. Following B-cell receptor (BCR) engagement by antigen, translocates to the plasma membrane through its PH domain. Plasma membrane localization is a critical step in the activation of BTK. A fraction of BTK also shuttles between the nucleus and the cytoplasm, and nuclear export is mediated by the nuclear export receptor CRM1.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, TEC subfamily
Target Tissue Specificity
Predominantly expressed in B-lymphocytes.
Target Research Area
Immunology
Target Synonyms
Agammaglobulinaemia tyrosine kinase; AGMX 1; AGMX1; AT; ATK; B cell progenitor kinase; B-cell progenitor kinase; BPK; Bruton agammaglobulinemia tyrosine kinase; Bruton tyrosine kinase; Bruton鈥檚 Tyrosine Kinase; Btk; BTK_HUMAN; dominant-negative kinase-deficient Brutons tyrosine kinase; IMD 1; IMD1; MGC126261; MGC126262; OTTHUMP00000063593; PSCTK 1; PSCTK1; truncated Bruton agammaglobulinemia tyrosine kinase; Tyrosine protein kinase BTK; Tyrosine-protein kinase BTK; tyrosine-protein kinase BTK isoform (lacking exon 14; XLA
Target Background
The protein encoded by this gene plays a crucial role in B-cell development. Mutations in this gene cause X-linked agammaglobulinemia type 1, which is an immunodeficiency characterized by the failure to produce mature B lymphocytes, and associated with a failure of Ig heavy chain rearrangement. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification