-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GM130 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GM130 (Q08379) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against GM130 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GM130 (Q08379) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16883A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GM130 |
| Target Synonyms | GM130; DEDHMB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Hep G2, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GM130 (Q08379). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MWPQPRLPPRPAMSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSM | Uniprot ID | Q08379 |
Uniprot Id
Q08379
Target Species
Human
Target Name
GOLGA2
Target Full Name
Golgin subfamily A member 2
Target Function
Peripheral membrane component of the cis-Golgi stack that acts as a membrane skeleton that maintains the structure of the Golgi apparatus, and as a vesicle thether that facilitates vesicle fusion to the Golgi membrane (Probable). Required for normal protein transport from the endoplasmic reticulum to the Golgi apparatus and the cell membrane. Together with p115/USO1 and STX5, involved in vesicle tethering and fusion at the cis-Golgi membrane to maintain the stacked and inter-connected structure of the Golgi apparatus. Plays a central role in mitotic Golgi disassembly: phosphorylation at Ser-37 by CDK1 at the onset of mitosis inhibits the interaction with p115/USO1, preventing tethering of COPI vesicles and thereby inhibiting transport through the Golgi apparatus during mitosis. Also plays a key role in spindle pole assembly and centrosome organization. Promotes the mitotic spindle pole assembly by activating the spindle assembly factor TPX2 to nucleate microtubules around the Golgi and capture them to couple mitotic membranes to the spindle: upon phosphorylation at the onset of mitosis, GOLGA2 interacts with importin-alpha via the nuclear localization signal region, leading to recruit importin-alpha to the Golgi membranes and liberate the spindle assembly factor TPX2 from importin-alpha. TPX2 then activates AURKA kinase and stimulates local microtubule nucleation. Upon filament assembly, nascent microtubules are further captured by GOLGA2, thus linking Golgi membranes to the spindle. Regulates the meiotic spindle pole assembly, probably via the same mechanism. Also regulates the centrosome organization. Also required for the Golgi ribbon formation and glycosylation of membrane and secretory proteins.
Target Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Peripheral membrane protein; Cytoplasmic side. Endoplasmic reticulum-Golgi intermediate compartment membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton, spindle pole.
Target Protein Families
GOLGA2 family
Target Synonyms
130 kDa cis Golgi matrix protein; 130 kDa cis-Golgi matrix protein; Cis golgi matrix protein GM130; GM130; Gm130 autoantigen; GOGA2_HUMAN; GOLGA 2; Golga2; Golgi autoantigen; Golgi autoantigen golgin subfamily a 2; Golgi matrix protein GM130; Golgin 95 ; golgin A2; Golgin subfamily a 2; Golgin subfamily A member 2; Golgin-95; MGC20672; SY11 protein
Target Background
The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined.
Notification