-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD34 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 286-385 of human CD34 (P28906) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD34 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 286-385 of human CD34 (P28906) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16981A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD34 |
| Target Synonyms | CD34; CD34 molecule; GIG3; MORT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 286-385 of human CD34 (P28906). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL | Uniprot ID | P28906 |
Uniprot Id
P28906
Target Species
Human
Target Name
CD34
Target Full Name
Hematopoietic progenitor cell antigen CD34
Target Function
Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
CD34 family
Target Tissue Specificity
Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues.
Target Synonyms
CD34; Hematopoietic progenitor cell antigen CD34; CD antigen CD34
Target Background
The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene.
Notification