-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CCR7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR7 (P32248) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CCR7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR7 (P32248) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16993A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CCR7 |
| Target Synonyms | BLR2; EBI1; CCR-7; CD197; CDw197; CMKBR7; CC-CKR-7; CCR7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, A-549, Jurkat, Mouse lung, Mouse spleen, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR7 (P32248). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNL | Uniprot ID | P32248 |
Uniprot Id
P32248
Target Species
Human
Target Name
CCR7
Target Full Name
C-C chemokine receptor type 7
Target Function
Receptor for the MIP-3-beta chemokine. Probable mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in various lymphoid tissues and activated B- and T-lymphocytes, strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.
Target Research Area
Others
Target Synonyms
CCR7; CMKBR7; EBI1; EVI1; C-C chemokine receptor type 7; C-C CKR-7; CC-CKR-7; CCR-7; BLR2; CDw197; Epstein-Barr virus-induced G-protein coupled receptor 1; EBV-induced G-protein coupled receptor 1; MIP-3 beta receptor; CD antigen CD197
Target Background
The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants.
Notification