Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HDAC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC2 (NP_001518.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against HDAC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC2 (NP_001518.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-17000A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HDAC2 |
| Target Synonyms | HD2; RPD3; YAF1; KDAC2; HDAC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, NIH/3T3, 293T, Mouse liver | Application | ELISA, WB, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC2 (NP_001518.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGED | Uniprot ID | Q92769 |
Uniprot Id
Q92769
Target Species
Human
Target Name
HDAC2
Target Full Name
Histone deacetylase 2
Target Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Histone deacetylase family, HD type 1 subfamily
Target Tissue Specificity
Widely expressed; lower levels in brain and lung.
Target Synonyms
D10Wsu179e; HD 2; HD2; HDAC 2; Hdac2; HDAC2_HUMAN; Histone deacetylase 2 (HD2); Histone deacetylase 2; OTTHUMP00000017046; OTTHUMP00000227077; OTTHUMP00000227078; RPD3; transcriptional regulator homolog RPD3; YAF1; YY1 associated factor 1; YY1 transcription factor binding protein ; Yy1bp
Target Background
This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3 and H4). This protein forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus, it plays an important role in transcriptional regulation, cell cycle progression and developmental events. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
