-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD20 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, FC, ELISA.
The antibody against CD20 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, FC, ELISA.
| Cat.No | ADA-17002A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD20 |
| Target Synonyms | B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Raji, U-937 | Application | ELISA, WB, FC, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF | Uniprot ID | P11836 |
Uniprot Id
P11836
Target Species
Human
Target Name
MS4A1
Target Full Name
B-lymphocyte antigen CD20
Target Function
B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR.
Target Involvement
Immunodeficiency, common variable, 5 (CVID5)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell membrane; Lipid-anchor.
Target Protein Families
MS4A family
Target Tissue Specificity
Expressed on B-cells.
Target Research Area
Immunology, Cancer
Target Synonyms
MS4A1; CD20; B-lymphocyte antigen CD20; B-lymphocyte surface antigen B1; Bp35; Leukocyte surface antigen Leu-16; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20
Target Background
This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.
Notification