-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SYT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 38-190 of human SYT4 (NP_065834.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SYT4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 38-190 of human SYT4 (NP_065834.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-00068A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SYT4 |
| Target Synonyms | HsT1192; SYT4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 38-190 of human SYT4 (NP_065834.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTS | Uniprot ID | Q9H2B2 |
Uniprot Id
Q9H2B2
Target Species
Human
Target Name
SYT4
Target Full Name
Synaptotagmin-4
Target Function
Synaptotagmin family member which does not bind Ca(2+). Involved in neuronal dense core vesicles (DCVs) mobility through its interaction with KIF1A. Upon increased neuronal activity, phosphorylation by MAPK8/JNK1 destabilizes the interaction with KIF1A and captures DCVs to synapses. Plays a role in dendrite formation by melanocytes.
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle, neuronal dense core vesicle membrane; Single-pass membrane protein.
Target Protein Families
Synaptotagmin family
Target Tissue Specificity
Expressed in melanocytes. Expressed in brain. Within brain, expression is highest in hippocampus, with substantial levels also detected in amygdala and thalamus.
Target Synonyms
SYT4; KIAA1342; Synaptotagmin-4; Synaptotagmin IV; SytIV
Target Background
Predicted to enable several functions, including calcium ion binding activity; phospholipid binding activity; and syntaxin binding activity. Involved in negative regulation of catecholamine secretion and positive regulation of dendrite extension. Predicted to be located in several cellular components, including microvesicle; perinuclear region of cytoplasm; and secretory vesicle. Predicted to be active in several cellular components, including axon; exocytic vesicle; and glutamatergic synapse. Predicted to be integral component of neuronal dense core vesicle membrane.
Notification