-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC26A9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-660 of human SLC26A9 (NP_443166.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC26A9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-660 of human SLC26A9 (NP_443166.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00150A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC26A9 |
| Target Synonyms | SLC26A9 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse stomach, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 500-660 of human SLC26A9 (NP_443166.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RNGYALAQVMDTDIYVNPKTYNRAQDIQGIKIITYCSPLYFANSEIFRQKVIAKTGMDPQKVLLAKQKYLKKQEKRRMRPTQQRRSLFMKTKTVSLQELQQDFENAPPTDPNNNQTPANGTSVSYITFSPDSSSPAQSEPPASAEAPGEPSDMLASVPPFV | Uniprot ID | Q7LBE3 |
Uniprot Id
Q7LBE3
Target Species
Human
Target Name
SLC26A9
Target Full Name
Solute carrier family 26 member 9
Target Function
DIDS- and thiosulfate- sensitive anion exchanger mediating chloride, sulfate and oxalate transport. Mediates chloride/bicarbonate exchange or chloride-independent bicarbonate extrusion thus assuring bicarbonate secretion. May prefer chloride anions and mediate uncoupled chloride anion transport in an alternate-access mechanism where a saturable binding site is alternately exposed to either one or the other side of the membrane.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
SLC26A/SulP transporter (TC 2.A.53) family
Target Tissue Specificity
Predominantly expressed in lung at the luminal side of the bronchiolar and alveolar epithelium of lung. To a lower extent, also expressed in pancreas and prostate.
Target Synonyms
SLC26A9; Solute carrier family 26 member 9; Anion transporter/exchanger protein 9
Target Background
This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns. The product of this gene is a highly selective chloride ion channel regulated by WNK kinases. Alternative splicing results in multiple transcript variants encoding differing isoforms.
Notification