-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CARD16 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human CARD16 (NP_001017534.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CARD16 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human CARD16 (NP_001017534.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00166A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CARD16 |
| Target Synonyms | COP; COP1; PSEUDO-ICE; LLID-114769; CARD16 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CARD16 (NP_001017534.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAALQAVQDNPAMPTCSSPEGRIKLCFLEDAQRIWKQKLQRCHVQNTIIKWSERYTSGSFE | Uniprot ID | Q5EG05 |
Uniprot Id
Q5EG05
Target Species
Human
Target Name
CARD16
Target Full Name
Caspase recruitment domain-containing protein 16
Target Function
Caspase inhibitor. Acts as a regulator of procaspase-1/CASP1 activation implicated in the regulation of the proteolytic maturation of pro-interleukin-1 beta (IL1B) and its release during inflammation. Inhibits the release of IL1B in response to LPS in monocytes. Also induces NF-kappa-B activation during the pro-inflammatory cytokine response. Also able to inhibit CASP1-mediated neuronal cell death, TNF-alpha, hypoxia-, UV-, and staurosporine-mediated cell death but not ER stress-mediated cell death. Acts by preventing activation of caspases CASP1 and CASP4, possibly by preventing the interaction between CASP1 and RIPK2.
Target Tissue Specificity
Widely expressed. Expressed at higher level in placenta, spleen, lymph node and bone marrow. Weakly or not expressed in thymus.
Target Synonyms
CAR16_HUMAN; CARD only domain-containing protein 1; CARD only protein ; CARD16; Caspase recruitment domain family, member 16; Caspase recruitment domain-containing protein 16; Caspase-1 dominant-negative inhibitor pseudo-ICE ; Caspase-1 inhibitor COP; COP; COP1; Pseudo interleukin 1 beta converting enzyme; Pseudo interleukin-1 beta converting enzyme; Pseudo interleukin-1beta converting enzyme ; PSEUDO-ICE
Target Background
Enables several functions, including CARD domain binding activity; cysteine-type endopeptidase inhibitor activity; and enzyme binding activity. Involved in several processes, including negative regulation of cysteine-type endopeptidase activity; regulation of gene expression; and regulation of signal transduction. Part of protease inhibitor complex.
Notification