Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CKLF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-67 of human CKLF (NP_057410.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CKLF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-67 of human CKLF (NP_057410.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00233A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CKLF |
| Target Synonyms | C32; CKLF1; CKLF2; CKLF3; CKLF4; UCK-1; HSPC224; CKLF | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Mouse thymus, Rat testis, Rat thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-67 of human CKLF (NP_057410.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDNVQPKIKHRPFCFSVKGHVKMLRLVFALVTAVCCLADGALIYRKLLFNPSGPYQKKPVHEKKEVL | Uniprot ID | Q9UBR5 |
Uniprot Id
Q9UBR5
Target Species
Human
Target Name
CKLF
Target Full Name
Chemokine-like factor
Target Function
May play an important role in inflammation and regeneration of skeletal muscle. Partly inhibited by interleukin 10.; has chemotactic response in monocytes, neutrophils and lymphocytes. Binds CCR4.
Target Subcellular Location
[Isoform 1]: Secreted.; [Isoform 2]: Membrane; Multi-pass membrane protein.; [Isoform 4]: Membrane; Multi-pass membrane protein.
Target Protein Families
Chemokine-like factor family
Target Tissue Specificity
Isoform 1, isoform 2, isoform 3 and isoform 4 have highest expression levels in adult spleen, lung, testis, ovary, peripheral blood leukocyte, placenta, pancreas, and in fetal brain, skeletal muscle, thymus and heart. Lower expression levels in adult skel
Target Synonyms
CKLF; CKLF1; HSPC224; UNQ410/PRO772; Chemokine-like factor; C32
Target Background
The product of this gene is a cytokine. Cytokines are small proteins that have an essential role in the immune and inflammatory responses. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. The protein encoded by this gene is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle. Alternatively spliced transcript variants encoding different isoforms have been identified. Naturally occurring read-through transcription occurs between this locus and the neighboring locus CMTM1 (CKLF-like MARVEL transmembrane domain containing 1).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
