Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPR82 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GPR82 (NP_543007.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPR82 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human GPR82 (NP_543007.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00241A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPR82 |
| Target Synonyms | GPR82 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Mouse testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GPR82 (NP_543007.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNNNTTCIQPSMISSMALPIIYILLCIVGVFGNTLSQWIFLTKIGKKTSTHIYLSHLVTANLLVCSAMPFMSIYFLKGFQWEYQSAQCRVVNFLGTLSMH | Uniprot ID | Q96P67 |
Uniprot Id
Q96P67
Target Species
Human
Target Name
GPR82
Target Full Name
Probable G-protein coupled receptor 82
Target Function
Orphan receptor.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Synonyms
GPR82; Probable G-protein coupled receptor 82
Target Background
The protein encoded by this gene is an orphan G protein-coupled receptor of unknown function. The encoded protein is a member of a family of proteins that contain seven transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
