-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MSY2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSY2 (NP_057066.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MSY2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSY2 (NP_057066.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00361A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MSY2 |
| Target Synonyms | DBPC; MSY2; CSDA3; CONTRIN | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse testis, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSY2 (NP_057066.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKW | Uniprot ID | Q9Y2T7 |
Uniprot Id
Q9Y2T7
Target Species
Human
Target Name
YBX2
Target Full Name
Y-box-binding protein 2
Target Function
Major constituent of messenger ribonucleoprotein particles (mRNPs). Involved in the regulation of the stability and/or translation of germ cell mRNAs. Binds to Y-box consensus promoter element. Binds to full-length mRNA with high affinity in a sequence-independent manner. Binds to short RNA sequences containing the consensus site 5'-UCCAUCA-3' with low affinity and limited sequence specificity. Its binding with maternal mRNAs is necessary for its cytoplasmic retention. May mark specific mRNAs (those transcribed from Y-box promoters) in the nucleus for cytoplasmic storage, thereby linking transcription and mRNA storage/translational delay.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Expressed in oocytes and testicular germ cells in the stage of spermatogonia to spermatocyte. Also observed placental trophoblasts, as well as in vascular smooth muscle cells in the pulmonary artery, myocardium, and skeletal muscle. Undetectable in epithe
Target Synonyms
Contrin; CSDA 3; CSDA3; Dbpc; DNA binding protein C; DNA-binding protein C; FRGY2 homolog; Germ cell specific Y box binding protein; Germ cell-specific Y-box-binding protein; MGC118270; MGC45104; MSY 2; MSY2; MSY2 homolog; OTTMUSP00000006276; RGD1305068; Y box binding protein 2; Y-box-binding protein 2; YBOX2_HUMAN; YBX 2; YBX2
Target Background
This gene encodes a nucleic acid binding protein which is highly expressed in germ cells. The encoded protein binds to a Y-box element in the promoters of certain genes but also binds to mRNA transcribed from these genes. Pseudogenes for this gene are located on chromosome 10 and 15.
Notification