Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RHOF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human RHOF (NP_061907.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RHOF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human RHOF (NP_061907.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00442A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RHOF |
| Target Synonyms | RIF; ARHF; RHOF | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-120 of human RHOF (NP_061907.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHF | Uniprot ID | Q9HBH0 |
Uniprot Id
Q9HBH0
Target Species
Human
Target Name
RHOF
Target Full Name
Rho-related GTP-binding protein RhoF
Target Function
Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Causes the formation of thin, actin-rich surface projections called filopodia. Functions cooperatively with CDC42 and Rac to generate additional structures, increasing the diversity of actin-based morphology.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm, cytoskeleton.
Target Protein Families
Small GTPase superfamily, Rho family
Target Synonyms
ARHF; FLJ20247; Ras homolog gene family member F (in filopodia); Ras homolog gene family member F; Rho F; Rho family GTPase Rif; Rho in filopodia; Rho related GTP binding protein RhoF; Rho-related GTP-binding protein RhoF; Rhof; RHOF_HUMAN; RIF
Target Background
Predicted to enable GTP binding activity; GTPase activity; and protein kinase binding activity. Involved in actin filament organization. Located in extracellular exosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
