Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLDND1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-138 of human CLDND1 (Q9NY35) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLDND1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-138 of human CLDND1 (Q9NY35) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00498A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLDND1 |
| Target Synonyms | Z38; C3orf4; GENX-3745; CLDND1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse kideny | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-138 of human CLDND1 (Q9NY35). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWR | Uniprot ID | Q9NY35 |
Uniprot Id
Q9NY35
Target Species
Human
Target Name
CLDND1
Target Full Name
Claudin domain-containing protein 1
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
PMP-22/EMP/MP20 family
Target Tissue Specificity
Widely distributed in the adult CNS with highest expression in the corpus callosum, caudate nucleus, cerebral cortex, medulla, putamen, spinal cord, substantia nigra and subthalamic nucleus. Weak expression was detected in the adult heart.
Target Synonyms
CLDND1; C3orf4; HSPC174; PSEC0054; UNQ2511/PRO6000; Claudin domain-containing protein 1; Membrane protein GENX-3745
Target Background
Located in cell surface.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
