Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 283-362 of human GPR4 (NP_005273.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPR4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 283-362 of human GPR4 (NP_005273.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00567A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPR4 |
| Target Synonyms | GPR6C.l; GPR4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | LO2, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 283-362 of human GPR4 (NP_005273.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PILYCLVNEGARSDVAKALHNLLRFLASDKPQEMANASLTLETPLTSKRNSTAKAMTGSWAATPPSQGDQVQLKMLPPAQ | Uniprot ID | P46093 |
Uniprot Id
P46093
Target Species
Human
Target Name
GPR4
Target Full Name
G-protein coupled receptor 4
Target Function
Proton-sensing G-protein coupled receptor couples to multiple intracellular signaling pathways, including GNAS/cAMP, GNAQ/phospholipase C (PLC), and GNA12/GNA13/Rho pathways. Acidosis-induced GPR4 activation increases paracellular gap formation and permeability of vascular endothelial cells through the GNA12/GNA13/Rho GTPase signaling pathway. In the brain may mediate central respiratory sensitivity to CO(2)H(+).
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Synonyms
GPR4; G-protein coupled receptor 4; G-protein coupled receptor 6C.l; GPR6C.l
Target Background
Enables G protein-coupled receptor activity. Involved in several processes, including G protein-coupled receptor signaling pathway; positive regulation of Rho protein signal transduction; and response to acidic pH. Located in plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
