-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADRA1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 346-475 of human ADRA1A (NP_150646.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ADRA1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 346-475 of human ADRA1A (NP_150646.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-00627A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADRA1A |
| Target Synonyms | ADRA1C; ADRA1L1; ALPHA1AAR; ADRA1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat heart, HL-60, LO2, Mouse spinal cord, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 346-475 of human ADRA1A (NP_150646.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LCRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARTKSRSVTRLECSGMILAHCNLRLPGSRDSPASASQAAGTTGMCHQADATRPS | Uniprot ID | P35348 |
Uniprot Id
P35348
Target Species
Human
Target Name
ADRA1A
Target Full Name
Alpha-1A adrenergic receptor
Target Function
This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine(PE)-stimulated ERK signaling in cardiac myocytes.
Target Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Membrane, caveola. Note=Location at the nuclear membrane facilitates heterooligomerization and regulates ERK-mediated signaling in cardiac myocytes. Colocalizes with GNAQ, PLCB1 as well as LAP2 at the nuclear membrane of cardiac myocytes.
Target Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA1A sub-subfamily
Target Tissue Specificity
Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in the prostate with hi
Target Research Area
Neuroscience
Target Synonyms
ADRA1A; ADRA1C; Alpha-1A adrenergic receptor; Alpha-1A adrenoreceptor; Alpha-1A adrenoceptor; Alpha-1C adrenergic receptor; Alpha-adrenergic receptor 1c
Target Background
Alpha-1-adrenergic receptors (alpha-1-ARs) are members of the G protein-coupled receptor superfamily. They activate mitogenic responses and regulate growth and proliferation of many cells. There are 3 alpha-1-AR subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. This gene encodes alpha-1A-adrenergic receptor. Alternative splicing of this gene generates four transcript variants, which encode four different isoforms with distinct C-termini but having similar ligand binding properties.
Notification