Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 67-250 of human PDP2 (NP_065837.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PDP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 67-250 of human PDP2 (NP_065837.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00652A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDP2 |
| Target Synonyms | PPM2B; PDPC 2; PPM2C2; PDP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Jurkat, Mouse liver, Rat liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 67-250 of human PDP2 (NP_065837.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPL | Uniprot ID | Q9P2J9 |
Uniprot Id
Q9P2J9
Target Species
Human
Target Name
PDP2
Target Full Name
[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
Target Function
Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
PP2C family
Target Research Area
Metabolism
Target Synonyms
[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2; KIAA1348 ; mitochondrial; PDP 2; Pdp2; PDP2_HUMAN; PDPC 2; PPM2B; PPM2C2; Protein phosphatase 2C magnesium dependent catalytic subunit 2; Protein phosphatase Mg2+/Mn2+ dependent 2B; Pyruvate dehydrogenase phosphatase 2; Pyruvate dehydrogenase phosphatase catalytic subunit 2; pyruvate dehydrogenase phosphatase isoenzyme 2 ; Pyruvate dehydrogenase phosphatase; catalytic subunit 2
Target Background
This gene is a mitochondrial protein that functions as a phosphatase and is involved in the enzymatic resetting of the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants encoding the same protein.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
