-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SH3BP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 784-963 of human SH3BP4 (NP_055336.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SH3BP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 784-963 of human SH3BP4 (NP_055336.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00656A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SH3BP4 |
| Target Synonyms | TTP; BOG25; SH3BP4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, BxPC-3, HepG2, Mouse brain, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 784-963 of human SH3BP4 (NP_055336.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TFFCRAELDSEPERVASVLEKLKEDCNNTENKERKSFQKELVMALLKMDCQGLVVRLIQDFVLLTTAVEVAQRWRELAEKLAKVSKQQMDAYESPHRDRNGVVDSEAMWKPAYDFLLTWSHQIGDSYRDVIQELHLGLDKMKNPITKRWKHLTGTLILVNSLDVLRAAAFSPADQDDFVI | Uniprot ID | Q9P0V3 |
Uniprot Id
Q9P0V3
Target Species
Human
Target Name
SH3BP4
Target Full Name
SH3 domain-binding protein 4
Target Function
May function in transferrin receptor internalization at the plasma membrane through a cargo-specific control of clathrin-mediated endocytosis. Alternatively, may act as a negative regulator of the amino acid-induced TOR signaling by inhibiting the formation of active Rag GTPase complexes. Preferentially binds inactive Rag GTPase complexes and prevents their interaction with the mTORC1 complex inhibiting its relocalization to lysosomes and its activation. Thereby, may indirectly regulate cell growth, proliferation and autophagy.
Target Subcellular Location
Membrane, clathrin-coated pit. Cytoplasmic vesicle, clathrin-coated vesicle. Nucleus. Note=Specifically associated with transferrin receptor-containing clathrin-coated pits and clathrin-coated vesicles. May also localize to the nucleus.
Target Tissue Specificity
Expressed in all tissues tested with higher expression in pancreas. Expressed by retinal pigment epithelial cells (at protein level).
Target Synonyms
BOG25; EH binding protein; EH binding protein 10; EH-binding protein 10; EHB10; SH3 domain binding protein 4; SH3 domain-binding protein 4; SH3B4_HUMAN; sh3bp4; Transferrin receptor trafficking protein; Transferrin receptor-trafficking protein; TTP
Target Background
This gene encodes a protein with 3 Asn-Pro-Phe (NPF) motifs, an SH3 domain, a PXXP motif, a bipartite nuclear targeting signal, and a tyrosine phosphorylation site. This protein is involved in cargo-specific control of clathrin-mediated endocytosis, specifically controlling the internalization of a specific protein receptor.
Notification