-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ITGAE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-200 of human ITGAE (NP_002199.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ITGAE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-200 of human ITGAE (NP_002199.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00861A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ITGAE |
| Target Synonyms | CD103; HUMINAE; ITGAE | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen, Mouse testis, Mouse thymus, Rat testis, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 19-200 of human ITGAE (NP_002199.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRALEKEEEEDKEEEEDEEEEEAG | Uniprot ID | P38570 |
Uniprot Id
P38570
Target Species
Human
Target Name
ITGAE
Target Full Name
Integrin alpha-E
Target Function
Integrin alpha-E/beta-7 is a receptor for E-cadherin. It mediates adhesion of intra-epithelial T-lymphocytes to epithelial cell monolayers.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Integrin alpha chain family
Target Tissue Specificity
Expressed on a subclass of T-lymphocytes known as intra-epithelial lymphocytes which are located between mucosal epithelial cells.
Target Synonyms
A530055J10; alpha-E1; alpha-M290; aM290; Antigen CD103; CD 103; CD103; CD103 antigen; HML 1 antigen; HML-1 antigen; HML1 antigen; Human mucosal lymphocyte antigen 1; Human mucosal lymphocyte antigen 1, alpha subunit; Huminae; Integrin alpha E; Integrin alpha E heavy chain; Integrin alpha E light chain; Integrin alpha E, epithelial-associated; Integrin alpha E1 ; Integrin alpha IEL ; Integrin alpha M290; Integrin alpha-E heavy chain; Integrin alpha-IEL; Integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1, alpha polypeptide); Integrin, alpha E; ITAE_HUMAN; Itgae; MGC141996; MGC183601; Mucosal lymphocyte 1 antigen; Mucosal lymphocyte antigen 1
Target Background
Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation.
Notification