Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CXCL14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-111 of human CXCL14 (NP_004878.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CXCL14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 35-111 of human CXCL14 (NP_004878.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00897A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CXCL14 |
| Target Synonyms | KEC; KS1; BMAC; BRAK; NJAC; MIP2G; MIP-2g; SCYB14; CXCL14 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 35-111 of human CXCL14 (NP_004878.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE | Uniprot ID | O95715 |
Uniprot Id
O95715
Target Species
Human
Target Name
CXCL14
Target Full Name
C-X-C motif chemokine 14
Target Function
Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine alpha (chemokine CxC) family
Target Tissue Specificity
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derived dendritic cells. N
Target Synonyms
1110031L23Rik; 1200006I23Rik; AI414372; BMAC; bolekine; BRAK; Breast and kidney; C-X-C motif chemokine 14; C-X-C motif chemokine ligand 14; Chaemokine; CXC motif; ligand 14; Chemokine (C-X-C motif) ligand 14; Chemokine BRAK; CXC chemokine in breast and kidney ; CXCL14; CXL14_HUMAN; JSC; Kec; Kidney-expressed chemokine CXC; KS1; MGC10687; MGC124510; MGC90667; MIP 2 gamma; MIP-2G; MIP2G; MIP2gamma; NJAC; PRO273; PSEC0212; Scyb14; Small Inducible Cytokine B14; Small inducible cytokine subfamily B (Cys-X-Cys) member 14 (BRAK); Small Inducible Cytokine subfamily B; member 14; Small-inducible cytokine B14; Tumor suppressing chemokine; UNQ240
Target Background
This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
