Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPIC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-212 of human PPIC (NP_000934.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PPIC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-212 of human PPIC (NP_000934.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00905A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPIC |
| Target Synonyms | CYPC; PPIC | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, MCF7, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-212 of human PPIC (NP_000934.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADW | Uniprot ID | P45877 |
Uniprot Id
P45877
Target Species
Human
Target Name
PPIC
Target Full Name
Peptidyl-prolyl cis-trans isomerase C
Target Function
PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Cyclophilin-type PPIase family
Target Tissue Specificity
Expressed in kidney, skeletal muscle, pancreas, heart, lung, liver and to a lower extent in brain.
Target Synonyms
Cyclophilin C; CYPC; MGC3673; Parvulin; Peptidyl prolyl cis trans isomerase C; Peptidyl-prolyl cis-trans isomerase C; Peptidylprolyl isomerase C (cyclophilin C); peptidylprolyl isomerase C; PPIase C; ppiC; PPIC_HUMAN; Rotamase C
Target Background
The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase)) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. Similar to other PPIases, this protein can bind immunosuppressant cyclosporin A.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
