Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EGFL7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-100 of human EGFL7 (NP_958854.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EGFL7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-100 of human EGFL7 (NP_958854.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00994A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EGFL7 |
| Target Synonyms | NEU1; ZNEU1; VE-STATIN; EGFL7 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse lung, Rat kidney, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-100 of human EGFL7 (NP_958854.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPG | Uniprot ID | Q9UHF1 |
Uniprot Id
Q9UHF1
Target Species
Human
Target Name
EGFL7
Target Full Name
Epidermal growth factor-like protein 7
Target Function
Regulates vascular tubulogenesis in vivo. Inhibits platelet-derived growth factor (PDGF)-BB-induced smooth muscle cell migration and promotes endothelial cell adhesion to the extracellular matrix and angiogenesis.
Target Subcellular Location
Secreted, extracellular space.
Target Synonyms
EGF like domain 7; EGF like domain containing protein 7; EGF like domain multiple 7; EGF-like protein 7; EGFL 7; EGFL7; EGFL7_HUMAN; Epidermal growth factor like domain protein 7; Epidermal growth factor-like protein 7; MEGF 7; MEGF7; MGC111117; Multiple EGF like domain protein 7; Multiple EGF-like domains protein 7; Multiple epidermal growth factor like domain protein 7; Multiple epidermal growth factor-like domains protein 7; NEU1; NEU1 protein; NOTCH4 like protein; NOTCH4-like protein; RP11 251M1.2; UNQ187/PRO1449; Vascular endothelial statin; VE statin; VE-statin; ZNEU 1; ZNEU1
Target Background
This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
