-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRPV3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPV3 (NP_659505.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRPV3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPV3 (NP_659505.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01153A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRPV3 |
| Target Synonyms | OLMS; VRL3; OLMS1; FNEPPK2; TRPV3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse pancreas, Mouse small intestine | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPV3 (NP_659505.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DNSVLEITVYNTNIDNRHEMLTLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMGWLQLLGRMFVLIWAMCISVK | Uniprot ID | Q8NET8 |
Uniprot Id
Q8NET8
Target Species
Human
Target Name
TRPV3
Target Full Name
Transient receptor potential cation channel subfamily V member 3
Target Function
Putative receptor-activated non-selective calcium permeant cation channel. It is activated by innocuous (warm) temperatures and shows an increased response at noxious temperatures greater than 39 degrees Celsius. Activation exhibits an outward rectification. May associate with TRPV1 and may modulate its activity. Is a negative regulator of hair growth and cycling: TRPV3-coupled signaling suppresses keratinocyte proliferation in hair follicles and induces apoptosis and premature hair follicle regression (catagen).
Target Involvement
Olmsted syndrome (OLMS); Palmoplantar keratoderma, non-epidermolytic, focal 2 (FNEPPK2)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Transient receptor (TC 1.A.4) family, TrpV subfamily, TRPV3 sub-subfamily
Target Tissue Specificity
Abundantly expressed in CNS. Widely expressed at low levels. Detected in dorsal root ganglion (at protein level). Expressed in the keratinocyte layers of the outer root sheath and, to lesser extent, to the matrix of the hair follicles (at protein level).
Target Research Area
Neuroscience
Target Synonyms
TRPV3; Transient receptor potential cation channel subfamily V member 3; TrpV3; Vanilloid receptor-like 3; VRL-3
Target Background
This gene product belongs to a family of nonselective cation channels that function in a variety of processes, including temperature sensation and vasoregulation. The thermosensitive members of this family are expressed in subsets of sensory neurons that terminate in the skin, and are activated at distinct physiological temperatures. This channel is activated at temperatures between 22 and 40 degrees C. This gene lies in close proximity to another family member gene on chromosome 17, and the two encoded proteins are thought to associate with each other to form heteromeric channels. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification