Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AIFM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human AIFM3 (NP_001018070.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against AIFM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human AIFM3 (NP_001018070.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01154A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AIFM3 |
| Target Synonyms | AIFL; AIFM3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, THP-1 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human AIFM3 (NP_001018070.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLSTPHPYPSPQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKVMAKCISPSAGYSSSTNVLIV | Uniprot ID | Q96NN9 |
Uniprot Id
Q96NN9
Target Species
Human
Target Name
AIFM3
Target Full Name
Apoptosis-inducing factor 3
Target Function
Induces apoptosis through a caspase dependent pathway. Reduces mitochondrial membrane potential.
Target Subcellular Location
Mitochondrion. Note=Does not translocate to the nucleus upon induction of apoptosis.
Target Protein Families
FAD-dependent oxidoreductase family
Target Tissue Specificity
Ubiquitous. Expressed in bone marrow, cerebral cortex, liver, ovary, thymus, thyroid gland and tongue (at protein level).
Target Synonyms
AIFL; Aifm3; AIFM3_HUMAN; Apoptosis inducing factor 3; Apoptosis inducing factor like; Apoptosis inducing factor like protein; Apoptosis inducing factor; mitochondrion associated; Apoptosis-inducing factor 3; Apoptosis-inducing factor-like protein; FLJ30473; FLJ45137
Target Background
Predicted to enable several functions, including 2 iron, 2 sulfur cluster binding activity; flavin adenine dinucleotide binding activity; and metal ion binding activity. Involved in execution phase of apoptosis. Located in cytosol; endoplasmic reticulum; and mitochondrial inner membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
