Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FGD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 99-198 of human FGD4 (NP_640334.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FGD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 99-198 of human FGD4 (NP_640334.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01156A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FGD4 |
| Target Synonyms | CMT4H; FRABP; ZFYVE6; FGD4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A-549, HepG2, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 99-198 of human FGD4 (NP_640334.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QMECEEEKAATLSSDTSIQASEPLLDTHIVNGERDETATAPASPTTDSCDGNASDSSYRTPGIGPVLPLEERGAETETKVQERENGESPLELEQLDQHHE | Uniprot ID | Q96M96 |
Uniprot Id
Q96M96
Target Species
Human
Target Name
FGD4
Target Full Name
FYVE, RhoGEF and PH domain-containing protein 4
Target Function
Activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. Plays a role in regulating the actin cytoskeleton and cell shape. Activates MAPK8.
Target Involvement
Charcot-Marie-Tooth disease 4H (CMT4H)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell projection, filopodium.
Target Tissue Specificity
Expressed in different tissues, including brain, cerebellum, peripheral nerve, skeletal muscle, heart, uterus, placenta and testis.
Target Synonyms
9030023J02Rik; 9330209B17Rik; Actin filament binding protein frabin; Actin filament-binding protein frabin; CMT4H; DKFZp313E1818; DKFZp434K1572; FGD1 related F actin binding protein; FGD1-related F-actin-binding protein; Fgd4; FGD4_HUMAN; FLJ34370; FLJ42663; FRABP; FYVE; FYVE; RhoGEF and PH domain containing 4; MGC57222; RhoGEF and PH domain-containing protein 4; ZFYVE6; Zinc finger FYVE domain containing protein 6; Zinc finger FYVE domain-containing protein 6
Target Background
This gene encodes a protein that is involved in the regulation of the actin cytoskeleton and cell shape. This protein contains an actin filament-binding domain, which together with its Dbl homology domain and one of its pleckstrin homology domains, can form microspikes. This protein can activate MAPK8 independently of the actin filament-binding domain, and it is also involved in the activation of CDC42 via the exchange of bound GDP for free GTP. The activation of CDC42 also enables this protein to play a role in mediating the cellular invasion of Cryptosporidium parvum, an intracellular parasite that infects the gastrointestinal tract. Mutations in this gene can cause Charcot-Marie-Tooth disease type 4H (CMT4H), a disorder of the peripheral nervous system. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
