Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UTP11L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-240 of human UTP11L (NP_057121.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UTP11L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-240 of human UTP11L (NP_057121.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01209A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UTP11L |
| Target Synonyms | CGI94; CGI-94; UTP11L | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse stomach, Mouse testis, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-240 of human UTP11L (NP_057121.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VAEAKKIERLKSELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPELVDRVFNRPRIETLQKEKVKGVTNQTGLKRIAKERQKQYNCLTQRIEREKKLFVIAQKIQTRKDLMDKTQKVKVKKETVN | Uniprot ID | Q9Y3A2 |
Uniprot Id
Q9Y3A2
Target Species
Human
Target Name
UTP11
Target Full Name
Probable U3 small nucleolar RNA-associated protein 11
Target Function
Involved in nucleolar processing of pre-18S ribosomal RNA.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
UTP11 family
Target Synonyms
CGI 94; CGI94; Probable U3 small nucleolar RNA associated protein 11; Probable U3 small nucleolar RNA-associated protein 11; U3 snoRNA associated protein 11; U3 snoRNA-associated protein 11; UTP 11L; UTP11 like protein; UTP11 like U3 small nucleolar ribonucleoprotein; UTP11-like protein; UTP11_HUMAN; Utp11l
Target Background
Enables RNA binding activity. Involved in nervous system development and positive regulation of apoptotic process. Located in cytoplasm; extracellular space; and nucleolus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
