-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AP1M1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human AP1M1 (NP_115882.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against AP1M1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human AP1M1 (NP_115882.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01276A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AP1M1 |
| Target Synonyms | AP47; mu1A; CLTNM; MU-1A; CLAPM2; AP1M1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, K-562, Mouse liver, Mouse testis, Mouse thymus, PC-3, Rat liver, Rat testis, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human AP1M1 (NP_115882.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWR | Uniprot ID | Q9BXS5 |
Uniprot Id
Q9BXS5
Target Species
Human
Target Name
AP1M1
Target Full Name
AP-1 complex subunit mu-1
Target Function
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
Target Subcellular Location
Golgi apparatus. Cytoplasmic vesicle, clathrin-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Note=Component of the coat surrounding the cytoplasmic face of coated vesicles located at the Golgi complex.
Target Protein Families
Adaptor complexes medium subunit family
Target Synonyms
Adaptor protein complex AP-1 mu-1 subunit; Adaptor-related protein complex 1 mu-1 subunit; AP-1 complex subunit mu-1; AP-mu chain family member mu1A; Ap1m1; AP1M1_HUMAN; AP47; CLAPM2; Clathrin adaptor protein AP47; Clathrin assembly protein complex 1 medium chain 1; Clathrin assembly protein complex 1 medium chain; Clathrin assembly protein complex AP1 mu subunit; Clathrin coat assembly protein AP47; Clathrin coat-associated protein AP47; CLTNM; Golgi adaptor AP 1 47 kDa protein; Golgi adaptor HA1/AP1 adaptin mu-1 subunit; HA1 47 kDa subunit; MU 1A; Mu-adaptin 1; Mu1A-adaptin
Target Background
The protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene.
Notification