Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TBXA2R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 229-343 of human TBXA2R (NP_001051.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TBXA2R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 229-343 of human TBXA2R (NP_001051.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01310A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TBXA2R |
| Target Synonyms | TXA2-R; BDPLT13; TBXA2R | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, HepG2, K-562, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 229-343 of human TBXA2R (NP_001051.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QEAAQQRPRDSEVEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWNQILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ | Uniprot ID | P21731 |
Uniprot Id
P21731
Target Species
Human
Target Name
TBXA2R
Target Full Name
Thromboxane A2 receptor
Target Function
Receptor for thromboxane A2 (TXA2), a potent stimulator of platelet aggregation. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 to glomerular TP receptors causes intense vasoconstriction. Activates phospholipase C.; Activates adenylyl cyclase.; Inhibits adenylyl cyclase.
Target Involvement
Bleeding disorder, platelet-type 13 (BDPLT13)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Synonyms
TBXA2R; Thromboxane A2 receptor; TXA2-R; Prostanoid TP receptor
Target Background
This gene encodes a member of the G protein-coupled receptor family. The protein interacts with thromboxane A2 to induce platelet aggregation and regulate hemostasis. A mutation in this gene results in a bleeding disorder. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
