Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against C6orf25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-142 of human C6orf25 (NP_612121.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against C6orf25 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-142 of human C6orf25 (NP_612121.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01314A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | C6orf25 |
| Target Synonyms | G6b; NG31; G6b-B; THAMY; C6orf25 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, K-562, Mouse pancreas, Mouse small intestine, Rat pancreas, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 18-142 of human C6orf25 (NP_612121.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ | Uniprot ID | O95866 |
Uniprot Id
O95866
Target Species
Human
Target Name
MPIG6B
Target Full Name
Megakaryocyte and platelet inhibitory receptor G6b
Target Function
Inhibitory receptor that acts as a critical regulator of hematopoietic lineage differentiation, megakaryocyte function and platelet production. Inhibits platelet aggregation and activation by agonists such as ADP and collagen-related peptide. This regulation of megakaryocate function as well as platelet production ann activation is done through the inhibition (via the 2 ITIM motifs) of the receptors CLEC1B and GP6:FcRgamma signaling. Appears to operate in a calcium-independent manner.; Isoform B, displayed in this entry, is the only isoform to contain both a transmembrane region and 2 immunoreceptor tyrosine-based inhibitor motifs (ITIMs) and, thus, the only one which probably has a role of inhibitory receptor. Isoform A may be the activating counterpart of isoform B
Target Involvement
Thrombocytopenia, anemia, and myelofibrosis (THAMY)
Target Subcellular Location
[Isoform E]: Endoplasmic reticulum. Golgi apparatus.; [Isoform D]: Endoplasmic reticulum. Golgi apparatus.; [Isoform B]: Cell membrane; Single-pass type I membrane protein.; [Isoform A]: Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed in platelets. Expressed in a restricted set of hematopoietic cell lines including the erythroleukemia cell line K-562 and the T-cell leukemia cell lines MOLT-4 and Jurkat. Not detected in the monocyte-like cell line U-937, the B-cell-like cell l
Target Synonyms
MPIG6B; C6orf25; G6B; G6B-B; Megakaryocyte and platelet inhibitory receptor G6b; Protein G6b
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
