-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC4A7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1151-1214 of human SLC4A7 (NP_003606.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC4A7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1151-1214 of human SLC4A7 (NP_003606.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01370A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC4A7 |
| Target Synonyms | NBC2; NBC3; SBC2; NBCN1; SLC4A6; SLC4A7 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1151-1214 of human SLC4A7 (NP_003606.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KKEKEEAERMLQDDDDTVHLPFEGGSLLQIPVKALKYSPDKPVSVKISFEDEPRKKYVDAETSL | Uniprot ID | Q9Y6M7 |
Uniprot Id
Q9Y6M7
Target Species
Human
Target Name
SLC4A7
Target Full Name
Sodium bicarbonate cotransporter 3
Target Function
Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na(+):HCO3(-) 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity.
Target Subcellular Location
Basolateral cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Cell projection, stereocilium.
Target Protein Families
Anion exchanger (TC 2.A.31) family
Target Tissue Specificity
Highly expressed in testis and spleen. Also expressed in retina, colon, small intestine, ovary, thymus, prostate, muscle, heart and kidney. Isoform 1 is expressed in skeletal muscle and heart muscle.
Target Synonyms
Bicarbonate transporter; BT; Electroneutral Na/HCO(3) cotransporter; NBC2; NBC3; S4A7; S4A7_HUMAN; SBC2; SLC4A6; Slc4a7; Sodium bicarbonate cotransporter 2; Sodium bicarbonate cotransporter 2b; Sodium bicarbonate cotransporter 3; Solute carrier family 4 member 7; Solute carrier family 4 sodium bicarbonate cotransporter member 7
Target Background
This locus encodes a sodium bicarbonate cotransporter. The encoded transmembrane protein appears to transport sodium and bicarbonate ions in a 1:1 ratio, and is thus considered an electroneutral cotransporter. The encoded protein likely plays a critical role in regulation of intracellular pH involved in visual and auditory sensory transmission. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Notification