-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GJB6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human GJB6 (NP_006774.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GJB6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human GJB6 (NP_006774.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01380A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GJB6 |
| Target Synonyms | ED2; EDH; HED; CX30; HED2; DFNA3; ECTD2; DFNA3B; DFNB1B; GJB6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GJB6 (NP_006774.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HETTRKFRRGEKRNDFKDIEDIKKQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDCFISRPTEKTVFTIFMISASV | Uniprot ID | O95452 |
Uniprot Id
O95452
Target Species
Human
Target Name
GJB6
Target Full Name
Gap junction beta-6 protein
Target Function
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Target Involvement
Ectodermal dysplasia 2, Clouston type (ECTD2); Deafness, autosomal recessive, 1B (DFNB1B); Deafness, autosomal dominant, 3B (DFNA3B)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Target Protein Families
Connexin family, Beta-type (group I) subfamily
Target Synonyms
GJB6; Gap junction beta-6 protein; Connexin-30; Cx30
Target Background
Gap junctions allow the transport of ions and metabolites between the cytoplasm of adjacent cells. They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments, two extracellular loops, a cytoplasmic loop formed between the two inner transmembrane segments, and the N- and C-terminus both being in the cytoplasm. The specificity of the gap junction is determined by which connexin proteins comprise the hemichannel. In the past, connexin protein names were based on their molecular weight, however the new nomenclature uses sequential numbers based on which form (alpha or beta) of the gap junction is present. This gene encodes one of the connexin proteins. Mutations in this gene have been found in some forms of deafness and in some families with hidrotic ectodermal dysplasia.
Notification