Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CDO1 (NP_001792.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDO1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CDO1 (NP_001792.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01393A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDO1 |
| Target Synonyms | CDO-I; CDO1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CDO1 (NP_001792.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN | Uniprot ID | Q16878 |
Uniprot Id
Q16878
Target Species
Human
Target Name
CDO1
Target Full Name
Cysteine dioxygenase type 1
Target Function
Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.
Target Protein Families
Cysteine dioxygenase family
Target Tissue Specificity
Highly expressed in liver and placenta. Low expression in heart, brain and pancreas. Also detected in hepatoblastoma Hep-G2 cells.
Target Research Area
Signal Transduction
Target Synonyms
CDO 1; CDO; CDO I; CDO-I; Cdo1; CDO1_HUMAN; CDOI; Cysteine dioxygenase type 1; Cysteine dioxygenase type I; Cytosolic cysteine dioxygenase
Target Background
Predicted to enable cysteine dioxygenase activity and ferrous iron binding activity. Predicted to be involved in L-cysteine catabolic process. Predicted to be located in cytosol.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
