-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRTC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 16-126 of human CRTC2 (NP_859066.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRTC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 16-126 of human CRTC2 (NP_859066.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01665A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRTC2 |
| Target Synonyms | TORC2; TORC-2; CRTC2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, PC-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 16-126 of human CRTC2 (NP_859066.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRRYTRHID | Uniprot ID | Q53ET0 |
Uniprot Id
Q53ET0
Target Species
Human
Target Name
CRTC2
Target Full Name
CREB-regulated transcription coactivator 2
Target Function
Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates gluconeogenesis as a component of the LKB1/AMPK/TORC2 signaling pathway. Regulates the expression of specific genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR).
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
TORC family
Target Tissue Specificity
Most abundantly expressed in the thymus. Present in both B and T-lymphocytes. Highly expressed in HEK293T cells and in insulinomas. High levels also in spleen, ovary, muscle and lung, with highest levels in muscle. Lower levels found in brain, colon, hear
Target Synonyms
CREB regulated transcription coactivator 2; CREB-regulated transcription coactivator 2; CRTC2; CRTC2_HUMAN; RP11-422P24.6 ; TORC-2; torc2; Transducer of CREB protein 2; Transducer of regulated cAMP response element-binding protein ; Transducer of regulated cAMP response element-binding protein (CREB) 2; Transducer of regulated cAMP response element-binding protein 2; Transducer of regulated CREB protein 2
Target Background
This gene encodes a member of the transducers of regulated cAMP response element-binding protein activity family of transcription coactivators. These proteins promote the transcription of genes targeted by the cAMP response element-binding protein, and therefore play an important role in many cellular processes. Under basal conditions the encoded protein is phosphorylated by AMP-activated protein kinase or the salt-inducible kinases and is sequestered in the cytoplasm. Upon activation by elevated cAMP or calcium, the encoded protein translocates to the nucleus and increases target gene expression. Single nucleotide polymorphisms in this gene may increase the risk of type 2 diabetes. A pseudogene of this gene is located on the long arm of chromosome 5.
Notification