Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RABGGTA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-360 of human RABGGTA (NP_878256.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RABGGTA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-360 of human RABGGTA (NP_878256.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01670A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RABGGTA |
| Target Synonyms | PTAR3; RABGGTA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 240-360 of human RABGGTA (NP_878256.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DPQDALRCLHVSRDEACLTVSFSRPLLVGSRMEILLLMVDDSPLIVEWRTPDGRNRPSHVWLCDLPAASLNDQLPQHTFRVIWTAGDVQKECVLLKGRQEGWCRDSTTDEQLFRCELSVEK | Uniprot ID | Q92696 |
Uniprot Id
Q92696
Target Species
Human
Target Name
RABGGTA
Target Full Name
Geranylgeranyl transferase type-2 subunit alpha
Target Function
Catalyzes the transfer of a geranylgeranyl moiety from geranylgeranyl diphosphate to both cysteines of Rab proteins with the C-terminal sequence -XXCC, -XCXC and -CCXX, such as RAB1A, RAB3A, RAB5A and RAB7A.
Target Protein Families
Protein prenyltransferase subunit alpha family
Target Synonyms
Geranylgeranyl transferase type 2 subunit alpha; Geranylgeranyl transferase type II subunit alpha; Geranylgeranyl transferase type-2 subunit alpha; PGTA_HUMAN; Protein prenyltransferase alpha subunit repeat containing 3; PTAR3; Rab geranyl geranyltransferase subunit alpha; Rab geranyl-geranyltransferase subunit alpha; Rab geranylgeranyltransferase alpha subunit; Rab geranylgeranyltransferase subunit alpha; Rab GG transferase alpha; Rab GGTase alpha; RABGGTA
Target Background
Predicted to enable small GTPase binding activity. Predicted to contribute to Rab geranylgeranyltransferase activity. Predicted to be involved in protein geranylgeranylation. Located in nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
