-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ARHGEF11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARHGEF11 (O15085) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ARHGEF11 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARHGEF11 (O15085) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01855A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ARHGEF11 |
| Target Synonyms | GTRAP48; PDZ-RHOGEF; ARHGEF11 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ARHGEF11 (O15085). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNS | Uniprot ID | O15085 |
Uniprot Id
O15085
Target Species
Human
Target Name
ARHGEF11
Target Full Name
Rho guanine nucleotide exchange factor 11
Target Function
May play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13). Acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase and may act as GTPase-activating protein (GAP) for GNA12 and GNA13. Involved in neurotrophin-induced neurite outgrowth.
Target Subcellular Location
Cytoplasm. Membrane. Note=Translocated to the membrane upon stimulation.
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
ARHGB_HUMAN; ARHGEF 11; ARHGEF11; DKFZp667F1223; Glutamate transporter EAAT4 associated protein 48; GTRAP 48; GTRAP48; KIAA0380; OTTHUMP00000038716; OTTHUMP00000038717; PDZ RHOGEF; PDZ-RhoGEF; Rho guanine exchange factor (GEF) 11; Rho guanine nucleotide exchange factor (GEF) 11; Rho guanine nucleotide exchange factor 11; RhoA specific guanine nucleotide exchange factor; RhoGEF glutamate transport modulator
Target Background
Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. A similar protein in rat interacts with glutamate transporter EAAT4 and modulates its glutamate transport activity. Expression of the rat protein induces the reorganization of the actin cytoskeleton and its overexpression induces the formation of membrane ruffling and filopodia. Two alternative transcripts encoding different isoforms have been described.
Notification